PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG004282.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YB
Protein Properties Length: 223aa    MW: 24286.7 Da    PI: 5.114
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG004282.4genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB83.62.4e-262573149
        NF-YB  1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49
                 vreqdr+lPian+srimkk+lPan+ki+kdak+tvqecvsefisfvts+
  CCG004282.4 25 VREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFVTSD 73
                 69*********************************************86 PP

2NF-YB68.51.2e-211001445296
        NF-YB  52 dkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                    cq+ekrktingddllwa+atlGfe+y++plkvyl++yre+  e
  CCG004282.4 100 LECQKEKRKTINGDDLLWAMATLGFEEYIDPLKVYLARYREVVLE 144
                  57***************************************9655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.3E-4220142IPR009072Histone-fold
SuperFamilySSF471134.19E-162374IPR009072Histone-fold
PfamPF008088.3E-163173IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.1E-165977No hitNo description
SuperFamilySSF471133.14E-13102143IPR009072Histone-fold
PRINTSPR006153.1E-16102120No hitNo description
PRINTSPR006153.1E-16121139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MADNPTSPAA GSHESGGEQS PRSGVREQDR YLPIANISRI MKKALPANGK IAKDAKDTVQ  60
ECVSEFISFV TSDGILWRTV FGGFGKMGCL LLFGNADGTL ECQKEKRKTI NGDDLLWAMA  120
TLGFEEYIDP LKVYLARYRE VVLESNLLTL LFSLVLLDDA MPQLEGDAKG SARGGDGSSK  180
REAVGGLPAQ NAQVNFCKHA LEVDYSVLVE VSPAYHIVFF LHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-3826140393NF-YB
4awl_B2e-3826140494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-3826140494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006378751.14e-89hypothetical protein POPTR_0010s22360g
RefseqXP_006378752.14e-89hypothetical protein POPTR_0010s22360g
RefseqXP_006378753.14e-89hypothetical protein POPTR_0010s22360g
SwissprotQ8VYK41e-61NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLU5G2H95e-89U5G2H9_POPTR; Uncharacterized protein
STRINGPOPTR_0010s22360.13e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.81e-62nuclear factor Y, subunit B1